Imagen ilustrativa del SARS COV-2, causante del COVID-19

Equipo de Investigación

Frente a la emergencia sanitaria en el Ecuador y el mundo ocasionada por la pandemia del COVID-19, es imperativo que la comunidad científica aúne esfuerzos para aportar a la búsqueda de elementos que permitan entender sus características y ayuden a encontrar medicinas y tratamientos que hagan frente a los graves efectos en la salud de los seres humanos. En función de ello, el equipo de investigadores conformado por el PhD. Saravana Prakash, MSc. Eduardo Estévez y el Ing. Fabián Jiménez inició la labor de investigación en el campo de la nanotecnología, la biología molecular, biofísica y ciencias de la computación, efectuando diversos estudios y simulaciones que permitan aportar significativamente a este problema mundial.

En este sentido, basados en estudios previos se encontró que la secuencia distintiva de la proteína GxxxG, que tiene una estructura tridimensional permite que ocurran interacciones de unión TM hélice-hélice dentro de la membrana, a nivel neuronal. Recientemente, un estudio sobre agentes causantes de Alzheimer revela que las mutaciones GxxxG que desestabilizan la fuerza de dimerización determinan los sitios de escisión de la γ-secretasa [1]. En la familia de proteínas GPCR, el estudio de microscopía de fluorescencia revela que un motivo GxxxG en TM hélice 1 del receptor del factor alfa de la proteína G es esencial para la oligo-merización del receptor. Además, APH-1 es una proteína de membrana integral multiespacio, el cuarto dominio TM de APH-1 la cual contiene una repetición en tándem GxxxG conservada (GxxxGxxxG) que son importantes para la asociación estable de APH-1 en el complejo g-secretasa. En la familia de la familia ErbB de receptores de factor de crecimiento tirosina quinasas, en la cual, ErbB1 tiene dos ejemplos del motivo similar a GxxxG, uno para homo-dimerización y el otro para heterodimerización. [2]. Estudios recientes en influenza HA y VIH Envelope han sugerido que tales motivos GXXXG también juegan un papel importante en la interacción FP (péptidos de fusión) -TMD o FP-FP. Había dos motivos GXXXG, GSIAG y GWTAG, dentro del FP de MERS-CoV. Mientras que recientemente fue encontrada (2020-03-13, YP_009725318, China Homo sapiens) la estructura de ectodominio de espiga -SARS-CoV-2 tiene 6 secuencias distintivas GXXXG, GWIFG, GWTAG, GCLIG, GDCLG, GWTFG y GDISG, como se muestra en la figura 1. Cabe señalar que, las longitudes de los FP de diferentes linajes de β-CoV también difieren significativamente, que van desde 18 aminoácidos para MHV a 22 aminoácidos para MERS-CoV y SARS-CoV. Hallazgos recientes de FP de SARS-CoV infieren que la ubicación exacta del péptido de fusión CoV (FP) está en disputa. Sin embargo, la evidencia sugiere que el dominio inmediatamente aguas abajo del sitio de escisión de S2 ‘es el FP, los aminoácidos 798-818 FIEDLLFNKVTLADAGFMKQY para SARS-CoV, FP1 y también los aminoácidos 816-835 KQYGECLGDINARDLICAQKF, también conocido como FP2, que inducen un ordenamiento significativo de la membrana. Mientras que la alineación de la secuencia de aminoácidos de FP1 y FP2 de SARS-CoV2 tiene una secuencia de FIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKF que tiene una similitud de secuencia del 93% con SARS-Cov (que se muestra en la Figura 2). En comparación con la alineación de la secuencia de aminoácidos de los pFP (posible FP) del SARS-CoV, el SARS-Cov2 tiene una similitud de secuencia del 85% con el SARS-Cov (que se muestra en la Fig3).

El equipo de investigadores, planea abordar los siguientes objetivos a través de varios modelos y simulaciones a nivel molecular y atómico:

1. Conocedores de que los estudios relacionados con la secuencia GxxxG en el proceso de dimerización del SARS CoV existen pero son limitados [3], se planea ampliar este enfoque de las secuencias GXXXG en el pPF de la proteína SARS-CoV2, mismas que son esenciales para la oligomerización o la interacción con el TMD.


2. Observar la simulación del mecanismo del proceso de fusión de la proteína de envoltura del dengue (película 1 y 2), que es una proteína de fusión de clase II que difiere completamente en comparación con la proteína de fusión de clase I, los péptidos de fusión de clase I generalmente son enriquecido en residuos de alanina y / o glicina, y el SARS-Cov2 tiene una sorprendente similitud con las proteínas de fusión de clase I, como ejemplo, la transición de HA antes y después de la fusión del virus de la influenza respalda los hallazgos experimentales de que los FP de clase I interactúan y se oligomerizan con sus TM en el lípido, que promueve la mezcla de lípidos y la fusión de membranas. Considerando estas observaciones, estamos experimentando pocas simulaciones para comprender el mecanismo de bucle de fusión del SARS-CoV2.


3. El tercer objetivo aún no ha sido planteado, puesto que los investigadores esperan que muchos más investigadores y profesionales con experticia se sumen a la misión, para definir otros objetivos de esta investigación, en la búsqueda de inhibidores que mermen el efecto del SARS-CoV2 causante del COVID-19. Por lo que hacen un llamado a científicos nacionales y extranjeros especialistas en biología molecular, virología, epidemiología, y otras ramas que se sumen a esta iniciativa.

(a) 6VYB|A Chain A, spike glycoprotein -SARS-CoV-2 spike ectodomain structure (open state)

(b) 6VYB|A Chain A, spike glycoprotein – Structure of the SARS-CoV-2 spike glycoprotein (closed state)

(c) 6NB6: A|PDBID|CHAIN|SEQUENCE SARS-COV

Fig 1 GxxxG motiff (red text), and pFPs (possible FP in green text) of SARS-CoV2 (a,b) and SARS-CoV (c) . FP1 (blue), FP2 (Yellow)

Fig 2 FP1 and FP2 of SARS-Cov2 has a 93% sequence similarity with SARS-Cov

B)

C)

La Fig. 3 SARS-Cov2 tiene una similitud de secuencia del 85% con SARS-Cov, los pFP se destacan en (b) y (c) que aparecen en forma de hélice y bobina. (Elaborado por Eduardo Estévez y Saravana Prakash)

6VSB_glicoprotein

Prefusion 2019-nCoV glicoproteína espiga con un solo dominio de unión al receptor
Clasificación: VIRAL PROTEIN
Sistema de expresión: Homo sapiens
Prefusion 2019-nCoV spike glycoprotein with a single receptor-binding domain up
DOI: 10.2210/pdb6VSB/pdb

En estudios previos efectuados en Dengue se encontraron características fundamentales que podrían ser la base para el estudio del SARS_Cov 2, a continuación se detalla el proceso de fusión de lípidos dengue-trímero antes y después de la entrada viral al organismo de un ser humano.

Lipid fusion-dengue-trimer’s
i) Pre to post conformation changes upon viral entry,
II) Aromatic cusp (violet) formed at fusioned stage

Lipid fusion 2
i) Pre to post conformation changes upon viral entry,
II) Aromatic cusp (violet) formed at fusioned stage, strong global motions at domain-III & I

Referencias

1. Munter, Lisa & Voigt, Philipp & Harmeier, Anja & Kaden, Daniela & Gottschalk, Kay & Weise, Christoph & Pipkorn, Rüdiger & Schaefer, Michael & Langosch, Dieter & Multhaup, Gerd. (2007). GxxxG motifs within the amyloid precursor protein transmembrane sequence are critical for the etiology of Aβ42. The EMBO journal. 26. 1702-12. 10.1038/sj.emboj.7601616.

2. Senes, Alessandro & Engel, Don & DeGrado, William. (2004). Folding of helical membrane proteins: the role of polar, GXXXG-like and proline motifs. Current opinion in structural biology. 14. 465-79.10.1016/j.sbi.2004.07.007.

3. Arbely, Eyal & Granot, Zvika & Kass, Itamar & Arkin, Isaiah. (2006). A Trimerizing GxxxG Motif Is Uniquely Inserted in the Severe Acute Respiratory Syndrome (SARS) Coronavirus Spike Protein Transmembrane Domain. Biochemistry. 45. 11349-56. 10.1021/bi060953v. https://www.ncbi.nlm.nih.gov/pubmed/16981695.

Contactos

Ing. Fabian Jimenez

Director of Technological Operations and High Performance Computing.
Lider de Proyecto
SIEMBRA EP
fjimenez@yachay.gob.ec

PhD. Saravana Prakash

Lider de Proyecto y colaborador como HPC – Consultant en SIEMBRA EP
Docente-Investigador
saravprak@googlemail.com.

Msc. Eduardo Estevez

Docente-Investigador
Colaborador del Proyecto
eduardoepr45@hotmail.com

Ms. Jananee Kannan

Graduate student, SSN Engineering college, India
Colaborador del Proyecto
jananee.b21@gmail.com

URCUQUI – ECUADOR